PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.366600.1
Common NameCsa_2G287110, LOC101212977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 558aa    MW: 61616.2 Da    PI: 6.5096
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.366600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-093573941954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Cucsa.366600.1 357 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 394
                     664559******************************88 PP

2BELL121.14.9e-39214285172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF++v+g  +a pYt+lA+ka+SrhFrcLkdai++q+
  Cucsa.366600.1 214 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDEVMGFRAAVPYTALAQKAMSRHFRCLKDAISSQL 285
                     589******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-76140283IPR006563POX domain
PfamPF075263.6E-53146282IPR006563POX domain
PROSITE profilePS5007112.568335398IPR001356Homeobox domain
CDDcd000863.76E-12338399No hitNo description
SMARTSM003891.2E-9338402IPR001356Homeobox domain
SuperFamilySSF466891.97E-17339405IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-29341404IPR009057Homeodomain-like
PfamPF059202.6E-18355394IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MFNFPPPPPP PPPQTDWYSN RQTINAADSA VAMQLFLMNP NPRSPSPPPP PPPSSTLHML  60
LPNPSSGGSY GQFTWGVVPQ QETNNDHSSS NPNEGRLSLS LSSSLEAAKA EELRMGDSNN  120
GLLYHHHHHP HVGIGSSNPL GVVNLLRNSK YIKAAQELLE EFCSVGRGQF KKNNHNNKSN  180
LPSNSNSHGG GGGDGAGVSS SSTKDHQPSL SATDRIEHQR RKVKLLSMLD EVDRRYNHYC  240
EQMQMVVNSF DEVMGFRAAV PYTALAQKAM SRHFRCLKDA ISSQLKHSCE MLGEKDGGVT  300
GRASGITKGE TPRLKLLEQS LRQQRAFHQM GIMEQEAWRP QRGLPERSVN ILRAWLFEHF  360
LHPYPSDADK HLLARQTGLS RNQVSNWFIN ARVRLWKPMV EEMYQQEAKD DDDDDHNNNN  420
NNSNNNNNNS DDEEEEEDTQ TNNNHQQIMN PLSQTPTLTP QPQALPPSSS AVAQTFPANN  480
YETELQDTCR RVSVLAAPDL QFGTTNAAAT SDIEGPTTLI RFGTTAGDVS LTLGLRHAGN  540
IPDQTSPFAL RSEFGGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16344402563Homeobox protein Meis2
3k2a_B2e-16344402563Homeobox protein Meis2
4xrm_A2e-16344402563Homeobox protein Meis2
4xrm_B2e-16344402563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819130.0LN681913.1 Cucumis melo genomic scaffold, anchoredscaffold00045.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649358.10.0PREDICTED: BEL1-like homeodomain protein 2
RefseqXP_011649357.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ94KL51e-147BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A0A0LM010.0A0A0A0LM01_CUCSA; Uncharacterized protein
STRINGGLYMA02G06730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-135BEL1-like homeodomain 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]